PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS70686.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family WOX
Protein Properties Length: 68aa    MW: 8152.38 Da    PI: 11.0715
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS70686.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.89e-19766256
                T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHH CS
    Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakek 56
                ++R+++++eq+++Le++F++   +p ++e++++  +l    ++ +++V++WFqNr+ + k
  EPS70686.1  7 KPRWNPKPEQVRILEAVFNSgMVNPPRDEIRKIRVQLqqygQVGDANVFYWFQNRKSRTK 66
                89*****************99************************************998 PP

2Wus_type_Homeobox1116.3e-36668264
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       a++RW+P+peQ++iLe++++sG+++P+++ei++i+ +L++yG+++d+NVfyWFQNrk+R + k
         EPS70686.1  6 AKPRWNPKPEQVRILEAVFNSGMVNPPRDEIRKIRVQLQQYGQVGDANVFYWFQNRKSRTKLK 68
                       689********************************************************9965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.75368IPR001356Homeobox domain
SMARTSM003890.0014568IPR001356Homeobox domain
SuperFamilySSF466892.52E-12666IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.3E-9766IPR009057Homeodomain-like
CDDcd000863.34E-5766No hitNo description
PfamPF000462.9E-16766IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 68 aa     Download sequence    Send to blast
ERIPEAKPRW NPKPEQVRIL EAVFNSGMVN PPRDEIRKIR VQLQQYGQVG DANVFYWFQN  60
RKSRTKLK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007212776.17e-39hypothetical protein PRUPE_ppa019841mg
RefseqXP_010111934.11e-38WUSCHEL-related homeobox 9
SwissprotA3B6V09e-38WOX12_ORYSJ; WUSCHEL-related homeobox 12
TrEMBLS8D0041e-43S8D004_9LAMI; Uncharacterized protein (Fragment)
STRINGGSMUA_Achr9P06660_0014e-38(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61662231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.19e-39homeobox-3
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]